calcoloscientifico:userguide:boltz2
Questa è una vecchia versione del documento!
Boltz2
Boltz2 Apptainer File Image
Boltz2 Apptainer File Image:
/hpc/share/containers/apptainer/boltz2/1.4.0/boltz2-1.4.0.sif
Boltz2 python script
Download the Boltz2 script file boltz2.py and save it:
- boltz2.py
import requests import json from typing import Dict, Any import os port = os.getenv('NIM_HTTP_API_PORT', '8000') print(port) SEQUENCE = "MTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVID" def query_boltz2_nim( input_data: Dict[str, Any], base_url: str = f"http://localhost:{port}" ) -> Dict[str, Any]: """ Query the Boltz2 NIM with input data. Args: input_data: Dictionary containing the prediction request data base_url: Base URL of the NIM service (default: http://localhost:8000) Returns: Dictionary containing the prediction response """ # Construct the full URL url = f"{base_url}/biology/mit/boltz2/predict" # Set headers headers = { "Content-Type": "application/json" } try: # Make the POST request response = requests.post(url, json=input_data, headers=headers) # Check if request was successful response.raise_for_status() # Return the JSON response return response.json() except requests.exceptions.RequestException as e: print(f"Error querying NIM: {e}") if hasattr(e.response, 'text'): print(f"Response text: {e.response.text}") raise # Example usage if __name__ == "__main__": # Example input data - modify this according to your BoltzPredictionRequest structure example_input = {"polymers":[ { "id": "A", "molecule_type": "protein", "sequence": SEQUENCE } ]} try: # Query the NIM result = query_boltz2_nim(example_input) # Print the result print("Prediction result:") print(json.dumps(result, indent=2)) except Exception as e: print(f"Failed to get prediction: {e}")
Boltz2 GPU job
Script slurm-boltz2-gpu-a100_40g.sh to run boltz2 on 1 node with 1 A100 (40 GB) GPU (8 tasks per node):
- slurm-boltz2-gpu-a100_40g.sh
#!/bin/bash --login #SBATCH --job-name=boltz2 #SBATCH --output=af_output/%x.d%j/%x.o%j #SBATCH --error=af_output/%x.d%j/%x.e%j #SBATCH --nodes=1 #SBATCH --ntasks-per-node=1 #SBATCH --cpus-per-task=8 #SBATCH --time=0-02:00:00 #SBATCH --mem=40G #SBATCH --partition=gpu #SBATCH --qos=gpu #SBATCH --gres=gpu:a100_40g:1 ##SBATCH --account=<account> shopt -q login_shell || exit 1 test -n "$SLURM_NODELIST" || exit 1 test $SLURM_NNODES -eq 1 || exit 1 module load apptainer module load boltz2 export NGC_API_KEY="INSERT API KEY HERE" export NIM_HTTP_API_PORT=$(hpc-find-free-tcp4-port) export TMPDIR=$HOME/nim-cache export APPTAINERENV_NGC_API_KEY=$NGC_API_KEY export APPTAINERENV_LOCAL_NIM_CACHE=/nim-cache export APPTAINERENV_NIM_CACHE=/nim-cache export APPTAINERENV_NIM_WORKSPACE=/nim-cache/workspace export APPTAINERENV_NIM_HTTP_API_PORT=$NIM_HTTP_API_PORT mkdir -p $HOME/nim-cache/workspace apptainer instance run \ --nv \ --bind $HOME/nim-cache:/nim-cache \ --bind $HOME/nim-cache:/opt/nim/.cache \ --bind $HOME/nim-cache/workspace:/opt/nim/workspace \ $BOLTZ2_CONTAINER $SLURM_JOB_ID apptainer instance list # Waiting for the boltz2 server to start until curl -sSf http://localhost:$NIM_HTTP_API_PORT/health/ready; do echo "Server not ready, waiting 10 seconds..." sleep 10 done echo "Boltz2 server ready!" # Testing boltz2 module load miniconda3 source "$CONDA_PREFIX/etc/profile.d/conda.sh" conda activate boltz2-env python $HOME/boltz2.py
calcoloscientifico/userguide/boltz2.1766000793.txt.gz · Ultima modifica: da fabio.spataro
